PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G163500.1
Common NamePHAVU_002G163500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 82aa    MW: 9430.68 Da    PI: 9.124
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G163500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33.2e-072362445
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++++E++l+ +  k+ G + W++Ia +++ gR ++++  +w 
  Phvul.002G163500.1 23 MSEQEEDLIHRMYKLVGDK-WNLIAGRIP-GRKAEEIERFWI 62
                        589**************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00551967IPR001005SANT/Myb domain
CDDcd001671.27E-42361No hitNo description
PfamPF002491.7E-62462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-102462IPR009057Homeodomain-like
SuperFamilySSF466896.47E-72462IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009913Biological Processepidermal cell differentiation
GO:0010063Biological Processpositive regulation of trichoblast fate specification
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MSTTATSTTS EEVSSKEWKV IHMSEQEEDL IHRMYKLVGD KWNLIAGRIP GRKAEEIERF  60
WIMRHTHAFS VTTNQSKAKH S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381152e-75KP238115.1 Lablab purpureus caprice (cpc) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158570.15e-54hypothetical protein PHAVU_002G163500g
SwissprotO220592e-29CPC_ARATH; Transcription factor CPC
SwissprotQ8GV052e-29TRY_ARATH; Transcription factor TRY
TrEMBLV7CKA15e-54V7CKA1_PHAVU; Uncharacterized protein
STRINGGLYMA01G43435.11e-38(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35832757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.11e-26MYB_related family protein